Paste a protein or peptide sequence to calculate its theoretical isoelectric point (pI), net charge at any pH, and a charge-versus-pH curve. Compare published pKa models, analyze FASTA records separately, and account for blocked termini.
Privacy note: calculations and exports run locally in your browser; your sequences are not uploaded.
What is the isoelectric point?
The isoelectric point (pI) is the pH at which a protein or peptide has zero modeled net charge. Below its pI it is generally positive; above its pI it is generally negative. A theoretical pI helps with buffer selection, isoelectric focusing, solubility screening, and ion-exchange chromatography, but it is not an experimental measurement.
Buffer and solubility guidance
Proteins often aggregate more readily near their pI because electrostatic repulsion is reduced. For solubility screening, test buffers away from the predicted pI and verify experimentally.
Ion-exchange guidance
At a working pH below pI, a protein is usually net positive and may bind a cation exchanger. Above pI it is usually net negative and may bind an anion exchanger. Surface charge and buffer ions also matter.
Worked examples
Short peptide: GKD
GKD
Method: IPC_peptide. Ionizable groups: N-term 1, C-term 1, D 1, K 1.
Calculating example…
Below its pI the peptide is net positive; above its pI it is net negative. Its two termini are a substantial fraction of all ionizable groups, so blocking either end can move the estimate.
Recognized protein: GFP (PDB 1B9C sequence)
ASKGEELFTGVVPILVELDGDVNGHKF…TAAGITHGMDELYK (238 aa)
Show the full entered GFP sequence
ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Method: IPC_protein. Ionizable side chains: calculating…
Calculating example…
At pH 7.4, above its predicted pI, GFP is expected to be net negative in this model. The published IPC 2.0 teaching example describes GFP as a well-studied protein with pI around 5.8.
Step-by-step: glycine and the neutral bracket
- Glycine has no ionizable side chain, so only its free C-terminus and N-terminus contribute.
- With EMBOSS values, the C-terminal pKa is 3.6 and the N-terminal pKa is 8.6. Between them, the dominant form has one positive and one negative charge.
- For this symmetric two-transition case, the neutral point is bracketed by those pKa values: pI ≈ (3.6 + 8.6) / 2 = 6.10.
Method, validation, and references
Calculator version
2.0.0
Last method review
17 July 2026
Supported alphabet
20 standard amino acids: ACDEFGHIKLMNPQRSTVWY
Model type
Sequence-only theoretical estimate
Automated benchmark checks
Running published IPC reference cases…
The embedded checks use the reference sequence and expected IPC_protein, IPC_peptide, and EMBOSS outputs published with the IPC package documentation. They verify the calculation engine on page load; they do not validate experimental accuracy.
Assumptions and limitations
- All residues of a type share the selected pKa, except the implemented Bjellqvist terminal-residue corrections.
- Folded microenvironments, coupled ionization, ligand binding, ionic strength, salt, and temperature are not modeled.
- PTMs are not inferred. Only N-terminal blocking/acetylation and C-terminal blocking/amidation are represented directly.
- Disulfide bonds are not inferred; paired cysteine thiols may therefore be overcounted.
- Highly basic proteins and values near the pH search boundaries deserve extra caution. Experimental IEF or capillary IEF remains the reference.
- IPC_protein and IPC_peptide here mean the published IPC 1.0 pKa presets. They are not the sequence-context machine-learning models used by IPC 2.0.
References
- EMBOSS 6.6 iep documentation and Epk.dat.
- Bjellqvist B. et al. (1993), “A nonlinear wide-range immobilized pH gradient for two-dimensional electrophoresis and its definition in a relevant pH scale.” Electrophoresis 14:1357–1365.
- ExPASy Compute pI/Mw documentation.
- Kozlowski LP. (2016), “IPC – Isoelectric Point Calculator.” Biology Direct 11:55.
- Kozlowski LP. (2021), “IPC 2.0: prediction of isoelectric point and pKa dissociation constants.” Nucleic Acids Research 49:W285–W292.
Frequently asked questions
Which pKa set should I choose?
Use IPC_protein for sequences longer than 50 residues and IPC_peptide for sequences of 50 residues or fewer as a practical starting rule. Use EMBOSS or Bjellqvist when reproducing those specific workflows, and compare the full method range for sensitivity to the pKa model.
What is the difference between protein and peptide models?
IPC_protein and IPC_peptide were optimized against different experimental datasets. Termini usually contribute more strongly to short peptides, while side-chain composition dominates larger proteins; the 50-residue recommendation used here is a transparent interface rule, not a biological boundary.
Why can this result differ from ExPASy or IPC?
Calculators may use different pKa sets, terminal-residue corrections, numerical procedures, sequence handling, or machine-learning models. This page implements the published Bjellqvist-style pKa calculation and IPC 1.0 optimized pKa presets, not the deep-learning IPC 2.0 predictor.
How do terminal modifications and disulfides affect pI?
N-terminal acetylation blocks the positive N-terminal group and C-terminal amidation blocks the negative C-terminal group. A disulfide removes the ionizable thiols of two cysteines; this calculator models terminal blocking explicitly but does not infer disulfide bonds.
Are multiple FASTA records supported?
Yes. Each FASTA record is parsed and calculated separately, shown in the batch table, and included in CSV export. Raw sequence without a FASTA header is treated as one record.
How are ambiguous or unsupported residues handled?
Only the 20 standard one-letter amino-acid codes are accepted. B, Z, X, U, O, J and other letters are reported with their positions and block calculation for that record rather than being silently removed.
What charge does a protein have above and below its pI?
In this sequence-only model, net charge is generally positive below the pI and negative above the pI. Close to the pI, low net charge can reduce electrostatic repulsion and may increase aggregation risk.
Why can predicted and experimental pI differ?
Uniform pKa models omit folded microenvironments, coupled ionization, salt, temperature, ligands and many post-translational modifications. Experimental pI can therefore differ substantially from a theoretical sequence estimate.
Are calculations private?
Yes. Sequence parsing, calculation, charting and CSV generation occur locally in your browser; sequences are not uploaded by this page.